PDB entry 1nut

View 1nut on RCSB PDB site
Description: CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE COMPLEXED WITH ATP ANALOG
Class: transferase
Keywords: nad biosynthesis, mitochondria, pyridine adenylyltransferase, enzyme catalysis, transferase
Deposited on 2003-02-01, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fksg76
    Species: Homo sapiens [TaxId:9606]
    Gene: FKSG76
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nuta_
  • Chain 'B':
    Compound: fksg76
    Species: Homo sapiens [TaxId:9606]
    Gene: FKSG76
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nutb_
  • Heterogens: SO4, APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nutA (A:)
    mksripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaa
    shhrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkal
    fstpaavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaesp
    ilrmhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglytkgstwk
    gkstqstegkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nutA (A:)
    sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
    hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllavpelkllcgadvlktf
    qtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisa
    tyirralgqgqsvkylipdavityikdhglyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nutB (B:)
    mksripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaa
    shhrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkal
    fstpaavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaesp
    ilrmhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglytkgstwk
    gkstqstegkts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nutB (B:)
    sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
    hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrvpelkllcgadvlktf
    qtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisa
    tyirralgqgqsvkylipdavityikdhglyt