PDB entry 1nun

View 1nun on RCSB PDB site
Description: Crystal Structure Analysis of the FGF10-FGFR2b Complex
Class: hormone/growth factor/membrane protein
Keywords: beta-trefoil fold, immunoglobulin-like domain, hormone/growth factor/membrane protein complex
Deposited on 2003-01-31, released 2003-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor-10
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nuna_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 2 isoform 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802
      • modified residue (22)
      • modified residue (46)
      • modified residue (49)
      • modified residue (78)
    Domains in SCOPe 2.06: d1nunb1, d1nunb2
  • Heterogens: SO4, 15P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nunA (A:)
    grhvrsynhlqgdvrwrklfsftkyflkiekngkvsgtkkencpysileitsveigvvav
    kainsnyylamnkkgklygskefnndcklkerieengyntyasfnwqhngrqmyvalngk
    gaprrgqktrrkntsahflpmvvhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nunA (A:)
    synhlqgdvrwrklfsftkyflkiekngkvsgtkkencpysileitsveigvvavkains
    nyylamnkkgklygskefnndcklkerieengyntyasfnwqhngrqmyvalngkgaprr
    gqktrrkntsahflpmvvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nunB (B:)
    aedfvsensnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefk
    qehriggykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilq
    aglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsgins
    snaevlalfnvteadageyickvsnyigqanqsawltvlpkqqapgreke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nunB (B:)
    krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
    nqhwslimesvvpsdkgnytcvveneygsinhtyhldvversphrpilqaglpanastvv
    ggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkhsginssnaevlalfnv
    teadageyickvsnyigqanqsawltvlp