PDB entry 1num

View 1num on RCSB PDB site
Description: u1a-utrrna, nmr, 25 structures
Class: complex (ribonucleoprotein/RNA)
Keywords: complex (ribonucleoprotein/RNA), nmr, rnp domain
Deposited on 1996-02-15, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 1997-03-12, with a file datestamp of 2007-04-25.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: u1a 102
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09012 (0-100)
    • conflict (29)
    • conflict (34)
  Domains in SCOPe 2.06: d1numa_
• Chain 'B':
  Compound: RNA 3utr
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1numA (A:)
  avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
  vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfv
  

  
  
• Chain 'B':
  No sequence available.