PDB entry 1nuk

View 1nuk on RCSB PDB site
Description: crystal structure of the ligand-binding domain of the ephb2 receptor tyrosine kinase
Class: transferase
Keywords: transferase, eph receptor tyrosine kinase,
Deposited on 1998-10-13, released 1999-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tyrosine-protein kinase receptor eph)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nuka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nukA (A:)
    eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
    rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
    tiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyrkcpr
    iiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nukA (A:)
    eetlmdsttataelgwmvhppsgweevsgydntirtyqvcnvfessqnnwlrtkfirrrg
    ahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvdtia
    adesfsqvdvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr