PDB entry 1nuk

View 1nuk on RCSB PDB site
Description: crystal structure of the ligand-binding domain of the ephb2 receptor tyrosine kinase
Deposited on 1998-10-13, released 1999-10-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-13, with a file datestamp of 1999-10-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.206
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nuka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nukA (A:)
    eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfir
    rrgahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvd
    tiaadesfsqvdlggrvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nukA (A:)
    eetlmdsttataelgwmvhppsgweevsgydntirtyqvcnvfessqnnwlrtkfirrrg
    ahrihvemkfsvrdcssipsvpgscketfnlyyyeadfdlatktfpnwmenpwvkvdtia
    adesfsqvdvmkintevrsfgpvsrngfylafqdyggcmsliavrvfyr