PDB entry 1nuf

View 1nuf on RCSB PDB site
Description: Role of Calcium Ions in the Activation and Activity of the Transglutaminase 3 Enzyme
Class: transferase
Keywords: Transglutaminase 3, X-ray crystallography, metalloenzyme, calcium ion, TRANSFERASE
Deposited on 2003-01-31, released 2003-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine glutamyltransferase E
    Species: Homo sapiens [TaxId:9606]
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • see remark 999 (249)
      • engineered (263)
      • see remark 999 (560)
      • see remark 999 (652)
    Domains in SCOPe 2.07: d1nufa1, d1nufa2, d1nufa3, d1nufa4
  • Heterogens: CL, BR, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nufA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nufA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpepsiigklkvagmlavgke
    vnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisya
    qyerylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfs
    npldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscn
    kfpaikamlsidvae