PDB entry 1nue

View 1nue on RCSB PDB site
Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with GDP at 2 angstroms resolution
Class: phosphotransferase
Keywords: nucleoside triphosphate, nucleoside diphosphate, phosphotransferase
Deposited on 1995-10-06, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nuea_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nueb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nuec_
  • Chain 'D':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nued_
  • Chain 'E':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nuee_
  • Chain 'F':
    Compound: Nucleoside diphosphate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nuef_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueA (A:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueB (B:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueC (C:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueD (D:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueE (E:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nueF (F:)
    anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
    pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
    svksaekeislwfkpeelvdykscahdwvye