PDB entry 1nuc

View 1nuc on RCSB PDB site
Description: staphylococcal nuclease, v23c variant
Deposited on 1997-02-15, released 1997-06-16
The last revision prior to the SCOP 1.57 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1nuc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nuc_ (-)
    lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws