PDB entry 1nub

View 1nub on RCSB PDB site
Description: helix c deletion mutant of bm-40 fs-ec domain pair
Deposited on 1997-12-05, released 1998-12-30
The last revision prior to the SCOP 1.69 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.255
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nubA (A:)
    aplapcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschff
    atkctlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednn
    lltekqklrvkkihenekrleagdhpeknynmyifpvhwqfgqldqhpidgylshtelap
    lraplipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nubA (A:)
    apcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschffatk
    ctlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednnllt
    ekqklrvkkihenekrleagdhpeknynmyifpvhwqfgqldqhpidgylshtelaplra
    plipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nubB (B:)
    aplapcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschff
    atkctlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednn
    lltekqklrvkkihenekrleagdhpeknynmyifpvhwqfgqldqhpidgylshtelap
    lraplipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nubB (B:)
    apcqnhhckhgkvceldenntpmcvcqdptscpapigefekvcsndnktfdsschffatk
    ctlegtkkghklhldyigpckyippcldseltefplrmrdwlknvlvtlyerdednnllt
    ekqklrvkkihenekrleagdhpeknynmyifpvhwqfgqldqhpidgylshtelaplra
    plipmehcttrffetcdldndkyialdewagcfgikqkdidkdlvi