PDB entry 1nu9

View 1nu9 on RCSB PDB site
Description: Staphylocoagulase-Prethrombin-2 complex
Class: hydrolase/hydrolase inhibitor
Keywords: Thrombin non-proteolytic activator, endocarditis, hydrolase-hydrolase inhibitor complex, protein binding
Deposited on 2003-01-31, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light and heavy chains
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nu9a_
  • Chain 'C':
    Compound: Staphylocoagulase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nu9c1, d1nu9c2
  • Chain 'D':
    Compound: Thrombin light and heavy chains
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nu9d_
  • Chain 'F':
    Compound: Staphylocoagulase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nu9f1, d1nu9f2
  • Heterogens: 0ZJ, HG, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nu9A (A:)
    geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
    gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
    rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
    tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
    fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nu9A (A:)
    geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
    gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
    rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
    tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
    fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu9C (C:)
    ivtkdyskesrvnenskygtlisdwylkgrltslesqfinalgiletyhygekeykdakd
    klmtrilgedqyllerkkvqyeeykklykkykeenptskvkmktfdqytiedltmreyne
    lteslksavkdfekdveiienqhhdlkpftdemeekatarvddlankaysvyfafvrdtq
    hktealelkakvdlvlgdedkphrisneriekemikdlesiiedffietglnkpdnitsy
    dsskhhyknhsegfealvketreavtnandswktktvkkyg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nu9D (D:)
    geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
    gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
    rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
    tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
    fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nu9D (D:)
    geadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellc
    gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
    rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
    tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
    fvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu9F (F:)
    ivtkdyskesrvnenskygtlisdwylkgrltslesqfinalgiletyhygekeykdakd
    klmtrilgedqyllerkkvqyeeykklykkykeenptskvkmktfdqytiedltmreyne
    lteslksavkdfekdveiienqhhdlkpftdemeekatarvddlankaysvyfafvrdtq
    hktealelkakvdlvlgdedkphrisneriekemikdlesiiedffietglnkpdnitsy
    dsskhhyknhsegfealvketreavtnandswktktvkkyg