PDB entry 1nu4

View 1nu4 on RCSB PDB site
Description: u1a rna binding domain at 1.8 angstrom resolution reveals a pre- organized c-terminal helix
Deposited on 2003-01-30, released 2003-02-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-14, with a file datestamp of 2003-02-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1nu4a_
  • Chain 'B':
    Domains in SCOP 1.63: d1nu4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu4A (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu4B (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakmk