PDB entry 1nu2

View 1nu2 on RCSB PDB site
Description: Crystal structure of the murine Disabled-1 (Dab1) PTB domain-ApoER2 peptide-PI-4,5P2 ternary complex
Class: signaling protein
Keywords: beta-sandwich
Deposited on 2003-01-30, released 2003-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disabled homolog 1
    Species: MUS MUSCULUS
    Gene: DAB1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nu2a_
  • Chain 'B':
    Compound: peptide derived from murine Apolipoprotein E Receptor-2
    Species: synthetic, synthetic
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu2A (A:)
    gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
    qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
    taqaaepvildlrdlfqliyelkqreelekka
    

  • Chain 'B':
    No sequence available.