PDB entry 1nu2

View 1nu2 on RCSB PDB site
Description: crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Deposited on 2003-01-30, released 2003-04-15
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1nu2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nu2A (A:)
  gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
  qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
  taqaaepvildlrdlfqliyelkqreelekka