PDB entry 1nu2

View 1nu2 on RCSB PDB site
Description: crystal structure of the murine disabled-1 (dab1) ptb domain-apoer2 peptide-pi-4,5p2 ternary complex
Deposited on 2003-01-30, released 2003-04-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-27, with a file datestamp of 2003-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nu2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nu2A (A:)
    gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
    qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
    taqaaepvildlrdlfqliyelkqreelekka