PDB entry 1ntv

View 1ntv on RCSB PDB site
Description: Crystal Structure of the Disabled-1 (Dab1) PTB domain-ApoER2 peptide complex
Class: signaling protein
Keywords: beta-sandwich, SIGNALING PROTEIN
Deposited on 2003-01-30, released 2003-04-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.222
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disabled homolog 1
    Species: Mus musculus [TaxId:10090]
    Gene: DAB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ntva_
  • Chain 'B':
    Compound: Apolipoprotein E Receptor-2 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NTV (0-9)
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntvA (A:)
    gqdrseatlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehk
    qkifltisfggikifdektgalqhhhavheisyiakditdhrafgyvcgkegnhrfvaik
    taqaaepvildlrdlfqliyelkqreelekka
    

  • Chain 'B':
    No sequence available.