PDB entry 1ntr

View 1ntr on RCSB PDB site
Description: solution structure of the n-terminal receiver domain of ntrc
Class: gene regulatory protein
Keywords: receiver domain, two-component system, gene regulatory protein
Deposited on 1994-09-16, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntrc receiver domain
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ntra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ntrA (A:)
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe