PDB entry 1ntp

View 1ntp on RCSB PDB site
Description: use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Deposited on 1987-09-16, released 1988-01-16
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: NEUT
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ntp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ntp_ (-)
ivggytcgantvpyqvslnsgyhfcggslidsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsydsntlnndimliklksaasldsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn