PDB entry 1ntp

View 1ntp on RCSB PDB site
Description: use of the neutron diffraction h/d exchange technique to determine the conformational dynamics of trypsin
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1987-09-16, released 1988-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NEUT
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • conflict (30)
      • conflict (76)
      • conflict (96)
    Domains in SCOPe 2.08: d1ntpa_
  • Heterogens: ISP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ntpA (A:)
ivggytcgantvpyqvslnsgyhfcggslidsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsydsntlnndimliklksaasldsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn