PDB entry 1nto

View 1nto on RCSB PDB site
Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form
Class: oxidoreductase
Keywords: archaeon, nad(h)-dependent, mutant, oxidoreductase
Deposited on 2003-01-30, released 2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntoa1, d1ntoa2
  • Chain 'B':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntob1, d1ntob2
  • Chain 'C':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntoc1, d1ntoc2
  • Chain 'D':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntod1, d1ntod2
  • Chain 'E':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntoe1, d1ntoe2
  • Chain 'H':
    Compound: NAD-dependent alcohol dehydrogenase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: ADH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39462 (0-346)
      • engineered (248)
    Domains in SCOPe 2.06: d1ntoh1, d1ntoh2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoA (A:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoB (B:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoC (C:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoD (D:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoE (E:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntoH (H:)
    mravrlveigkplslqeigvpkpkgpqvlikveaagvchsdvhmrqgrfgnlrivedlgv
    klpvtlgheiagkieevgdevvgyskgdlvavnpwqgegncyycrigeehlcdsprwlgi
    nfdgayaeyvivphykymyklrrlnaveaapltcsgittyravrkasldptktllvvgag
    gglgtmavqiakavsgatiigvdvreeaveaakragadyvinasmqdplaeirriteskg
    vdavidlnysektlsvypkalakqgkyvmvglfgadlhyhaplitlseiqfvgslvgnqs
    dflgimrlaeagkvkpmitktmkleeaneaidnlenfkaigrqvlip