PDB entry 1ntn

View 1ntn on RCSB PDB site
Description: the crystal structure of neurotoxin-I from naja naja oxiana at 1.9 angstroms resolution
Class: postsynaptic neurotoxin
Keywords: postsynaptic neurotoxin
Deposited on 1994-09-26, released 1995-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neurotoxin I
  Species: Naja oxiana [TaxId:8657]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01382 (0-71)
    • conflict (61)
  Domains in SCOPe 2.08: d1ntna_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ntnA (A:)
  itcyktpiitsetcapgqnlcytktwcdawcgsrgkvielgcaatcptvesyqdikccst
  dncnphpkqkrp