PDB entry 1nth

View 1nth on RCSB PDB site
Description: Crystal structure of the methanosarcina barkeri monomethylamine methyltransferase (MTMB)
Class: transferase
Keywords: tim barrel, transferase
Deposited on 2003-01-30, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monomethylamine methyltransferase mtmB1
    Species: Methanosarcina barkeri [TaxId:2208]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ntha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nthA (A:)
    mtfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmme
    klfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgd
    kakpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaa
    ktetrliknacamagrpgmgvxgpetslsaqgnisadctggmtctdshevsqlnelkidl
    daisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvh
    irwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasg
    reilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasap
    agktfqecydvktvtpteeymqvydgarkkledlglvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nthA (A:)
    tfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmmek
    lfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgdk
    akpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaak
    tetrliknacamagrpgmgvxgpetslsaqgnisadctggmtctdshevsqlnelkidld
    aisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvhi
    rwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasgr
    eilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasapa
    gktfqecydvktvtpteeymqvydgarkkledlglvf