PDB entry 1ntg

View 1ntg on RCSB PDB site
Description: crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
Deposited on 2003-01-29, released 2003-05-13
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-13, with a file datestamp of 2003-05-13.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.251
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ntga_
  • Chain 'B':
    Domains in SCOP 1.71: d1ntgb_
  • Chain 'C':
    Domains in SCOP 1.71: d1ntgc_
  • Chain 'D':
    Domains in SCOP 1.71: d1ntgd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ntgA (A:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgA (A:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ntgB (B:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgB (B:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ntgC (C:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgC (C:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ntgD (D:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgD (D:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle