PDB entry 1ntg

View 1ntg on RCSB PDB site
Description: Crystal Structure of the EMAP II-like Cytokine Released from human tyrosyl-tRNA Synthetase
Class: ligase
Keywords: beta barrel, LIGASE
Deposited on 2003-01-29, released 2003-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54577 (Start-169)
      • cloning artifact (170-171)
    Domains in SCOPe 2.07: d1ntga1, d1ntga2
  • Chain 'B':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54577 (Start-169)
      • cloning artifact (170-171)
    Domains in SCOPe 2.07: d1ntgb1, d1ntgb2
  • Chain 'C':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54577 (Start-169)
      • cloning artifact (170-171)
    Domains in SCOPe 2.07: d1ntgc1, d1ntgc2
  • Chain 'D':
    Compound: Tyrosyl-tRNA synthetase
    Species: Homo sapiens [TaxId:9606]
    Gene: YARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54577 (Start-169)
      • cloning artifact (170-171)
    Domains in SCOPe 2.07: d1ntgd1, d1ntgd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ntgA (A:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgA (A:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ntgB (B:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgB (B:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ntgC (C:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgC (C:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ntgD (D:)
    epeevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdr
    lvvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpd
    eelkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntgD (D:)
    peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl
    vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde
    elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle