PDB entry 1ntf

View 1ntf on RCSB PDB site
Description: Crystal Structure of Cimex Nitrophorin
Class: transport protein
Keywords: ferric heme protein, beta sandwich, NO carrier, TRANSPORT PROTEIN
Deposited on 2003-01-29, released 2004-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ntfA (A:)
    gsppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpac
    vknfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivt
    sftiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetna
    thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatps
    wtdralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntfA (A:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl