PDB entry 1ntc

View 1ntc on RCSB PDB site
Description: solution structure of the DNA-binding domain of ntrc with three alanine substitutions
Class: transcription regulation
Keywords: helix-turn-helix, fis, four-helix bundle, transcription regulation
Deposited on 1999-05-26, released 1999-06-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nitrogen regulation protein (ntrc))
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41789 (0-90)
      • cloning artifact (0)
      • engineered (77-78)
      • engineered (82)
    Domains in SCOPe 2.07: d1ntca1, d1ntca2
  • Chain 'B':
    Compound: protein (nitrogen regulation protein (ntrc))
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41789 (0-90)
      • cloning artifact (0)
      • engineered (77-78)
      • engineered (82)
    Domains in SCOPe 2.07: d1ntcb1, d1ntcb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntcA (A:)
    mdlpgelfeastpdspshlppdswatllaqwadralrsghqnllseaqpelertllttal
    rhtqghkqeaarllgwgaatltaklkelgme
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntcB (B:)
    mdlpgelfeastpdspshlppdswatllaqwadralrsghqnllseaqpelertllttal
    rhtqghkqeaarllgwgaatltaklkelgme