PDB entry 1nt7

View 1nt7 on RCSB PDB site
Description: Crystal structure of lactose synthase in the presence of UDP-glucose
Class: transferase activator/transferase
Keywords: alpha-lactalbumin; beta,1,4-galactosyltransferase; UDP-glucose
Deposited on 2003-01-29, released 2003-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-02-25, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nt7a_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed):
    • GB AAM54035
    Domains in SCOPe 2.07: d1nt7b_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: MUS MUSCULUS
    Gene: Lalba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nt7c_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: BOS TAURUS
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed):
    • GB AAM54035 (14-285)
    Domains in SCOPe 2.07: d1nt7d_
  • Heterogens: GDU, CA, MN, UDP, PG4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nt7A (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nt7B (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt7B (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nt7C (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nt7D (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt7D (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps