PDB entry 1nt0

View 1nt0 on RCSB PDB site
Description: crystal structure of the cub1-egf-cub2 region of masp2
Deposited on 2003-01-28, released 2003-05-20
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nt0A (A:)
    skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
    tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaedv
    decrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflssp
    eypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpydslkiqtdkreygpfc
    gktlpprietdsnkvtitfttdesgnhtgwkihytstaqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt0A (A:)
    epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
    kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaedvdecrpcdh
    ychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflsspeypqpypklsscayn
    irleegfsitldfvesfdvemhcdslkiqtdkreygpfcgktlpprietdsnkvtitftt
    desgnhtgwkihytsta
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nt0G (G:)
    skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
    tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaedv
    decrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflssp
    eypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpydslkiqtdkreygpfc
    gktlpprietdsnkvtitfttdesgnhtgwkihytstaqphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nt0G (G:)
    epvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkltsgt
    kvlatlcgqestdterapgndtfyslgpslkvtfhsdypftgfeafyaaedvdecrpcdh
    ychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflsspeypqpypklsscayn
    irleegfsitldfvesfdvemhcdslkiqtdkreygpfcgktlpprietdsnkvtitftt
    desgnhtgwkihytsta