PDB entry 1nsp

View 1nsp on RCSB PDB site
Description: mechanism of phosphate transfer by nucleoside diphosphate kinase: x-ray structures of a phospho-histidine intermediate of the enzymes from drosophila and dictyostelium
Class: phosphotransferase
Keywords: nucleoside triphosphate: nucleoside diphosphate, phosphotransferase
Deposited on 1995-04-18, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nspa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nspA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    ihgsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nspA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye