PDB entry 1nso

View 1nso on RCSB PDB site
Description: folded monomer of protease from mason-pfizer monkey virus
Deposited on 2003-01-28, released 2003-02-18
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1nsoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nsoA (A:)
  wvqpitaqkpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnn
  pkqsskyltwrdkennsglikpfvipnlpvnlwgrdllsqmkimmas