PDB entry 1nsn

View 1nsn on RCSB PDB site
Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution
Class: complex (immunoglobulin/hydrolase)
Keywords: immunoglobulin, staphylococcal nuclease
Deposited on 1995-06-06, released 1995-09-15
The last revision prior to the SCOP 1.73 freeze date was dated 1995-09-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg fab (igg1, kappa)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAB06744 (0-209)
      • conflict (28)
      • conflict (31)
      • conflict (48)
      • conflict (52)
      • conflict (56)
      • conflict (70)
      • conflict (80)
      • conflict (91)
      • conflict (93)
      • conflict (96)
      • conflict (98-101)
      • conflict (107-108)
      • conflict (112)
      • conflict (186-187)
    Domains in SCOP 1.73: d1nsnh1, d1nsnh2
  • Chain 'L':
    Compound: igg fab (igg1, kappa)
    Species: Mus musculus
    Domains in SCOP 1.73: d1nsnl1, d1nsnl2
  • Chain 'S':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus
    Gene: NUCLEASE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nsns_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsnH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgttsy
    npslksrisisrdtsknqffmqlnsvttedtgtfyctrgngdwgqgttltvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nsnL (L:)
    divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
    gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsnL (L:)
    divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
    gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1nsnS (S:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsendadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsnS (S:)
    tkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftk
    kmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheq
    hlrkseaqakkeklniws