PDB entry 1nsn

View 1nsn on RCSB PDB site
Description:
Deposited on 1995-06-06, released 1995-09-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nsnh1, d1nsnh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nsnl1, d1nsnl2
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nsns_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsnH (H:)
    dvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgttsy
    npslksrisisrdtsknqffmqlnsvttedtgtfyctrgngdwgqgttltvssakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nsnL (L:)
    divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
    gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsnL (L:)
    divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
    gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1nsnS (S:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsendadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsnS (S:)
    tkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftk
    kmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheq
    hlrkseaqakkeklniws