PDB entry 1nsl

View 1nsl on RCSB PDB site
Description: Crystal structure of Probable acetyltransferase
Class: transferase
Keywords: Structural genomics, Hexamer, Alpha-Beta, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2003-01-27, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.258
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nsla1, d1nsla2
  • Chain 'B':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nslb1, d1nslb2
  • Chain 'C':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nslc1, d1nslc2
  • Chain 'D':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nsld1, d1nsld2
  • Chain 'E':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nsle1, d1nsle2
  • Chain 'F':
    Compound: Probable acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YDAF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96579 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (81)
      • modified residue (165)
    Domains in SCOPe 2.07: d1nslf1, d1nslf2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nslA (A:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslA (A:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffssadtyretiipdwrrqya
    dlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafe
    elelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nslB (B:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslB (B:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffssadtyretiipdwrrqya
    dlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafe
    elelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nslC (C:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslC (C:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nslD (D:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslD (D:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nslE (E:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslE (E:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffenpssadtyretiipdwrr
    qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
    afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nslF (F:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
    rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
    yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
    egek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nslF (F:)
    gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffpssadtyretiipdwrrqy
    adlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityaf
    eelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew