PDB entry 1nsj

View 1nsj on RCSB PDB site
Description: crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOP 1.67 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1nsj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nsj_ (-)
mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf
vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre
fpilldtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvs
sgveafpgkkdhdsikmfiknakgl