PDB entry 1nsi

View 1nsi on RCSB PDB site
Description: human inducible nitric oxide synthase, zn-bound, l-arg complex
Class: oxidoreductase
Keywords: nitric oxide synthase, heme protein, tetrahydrobiopterin
Deposited on 1999-01-10, released 2000-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 2000-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nsia_
  • Chain 'B':
    Compound: protein (nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nsib_
  • Chain 'C':
    Compound: protein (nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nsic_
  • Chain 'D':
    Compound: protein (nitric oxide synthase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nsid_
  • Heterogens: SO4, ZN, HEM, H4B, ARG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nsiA (A:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsiA (A:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nsiB (B:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsiB (B:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nsiC (C:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsiC (C:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nsiD (D:)
    ldatplssprhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkp
    tppdellpqaiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqa
    wrnaprcigriqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdg
    khdfrvwnaqliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqang
    rdpelfeippdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwy
    mgteigvrdfcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvti
    mdhhsaaesfmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqv
    eawkthvwqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nsiD (D:)
    rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
    aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
    riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
    qliryagyqmpdgsirgdpanveftqlcidlgwkpkygrfdvvplvlqangrdpelfeip
    pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
    fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
    fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq