PDB entry 1nsh

View 1nsh on RCSB PDB site
Description: Solution Structure of Rabbit apo-S100A11 (19 models)
Class: metal binding protein
Keywords: calcium-binding protein, EF hand, helix-loop-helix, S100, Annexin, METAL BINDING PROTEIN
Deposited on 2003-01-27, released 2003-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-12-16, with a file datestamp of 2008-12-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calgizzarin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: S100A11 OR S100C OR PCALG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nsha_
  • Chain 'B':
    Compound: Calgizzarin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: S100A11 OR S100C OR PCALG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nshb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nshA (A:)
    srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
    kkldlnsdgqldfqeflnligglavachesfvkaappqkrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nshB (B:)
    srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
    kkldlnsdgqldfqeflnligglavachesfvkaappqkrf