PDB entry 1nsh

View 1nsh on RCSB PDB site
Description: Solution Structure of Rabbit apo-S100A11 (19 models)
Class: metal binding protein
Keywords: calcium-binding protein, EF hand, helix-loop-helix, S100, Annexin, METAL BINDING PROTEIN
Deposited on 2003-01-27, released 2003-07-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-12-16, with a file datestamp of 2008-12-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Calgizzarin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Gene: S100A11 OR S100C OR PCALG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24480 (0-100)
  Domains in SCOP 1.75: d1nsha_
• Chain 'B':
  Compound: Calgizzarin
  Species: Oryctolagus cuniculus [TaxId:9986]
  Gene: S100A11 OR S100C OR PCALG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24480 (0-100)
  Domains in SCOP 1.75: d1nshb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nshA (A:)
  srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
  kkldlnsdgqldfqeflnligglavachesfvkaappqkrf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nshB (B:)
  srpteterciesliavfqkyagkdghsvtlskteflsfmntelaaftknqkdpgvldrmm
  kkldlnsdgqldfqeflnligglavachesfvkaappqkrf