PDB entry 1nsg

View 1nsg on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Class: complex (isomerase/kinase)
Keywords: COMPLEX (ISOMERASE-KINASE), TRANSFERASE, FKBP12, FRAP, RAPAMYCIN, COMPLEX (ISOMERASE-KINASE) complex
Deposited on 1997-07-01, released 1998-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nsga_
  • Chain 'B':
    Compound: fkbp-rapamycin associated protein (frap)
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nsgb_
  • Heterogens: RAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsgA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsgB (B:)
    vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdltqawdlyyhvfrris