PDB entry 1nsd

View 1nsd on RCSB PDB site
Description: influenza b virus neuraminidase can synthesize its own inhibitor
Deposited on 1993-05-24, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nsda_
  • Chain 'B':
    Domains in SCOP 1.55: d1nsdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsdA (A:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsdB (B:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal