PDB entry 1nsb

View 1nsb on RCSB PDB site
Description: the 2.2 angstroms resolution crystal structure of influenza b neuraminidase and its complex with sialic acid
Deposited on 1991-08-08, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.148
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nsba_
  • Chain 'B':
    Domains in SCOP 1.55: d1nsbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsbA (A:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsbB (B:)
    epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
    aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
    dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
    regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
    mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
    melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
    twhsaataiyclmgsgqllwdtvtgvdmal