PDB entry 1nsa

View 1nsa on RCSB PDB site
Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
Class: serine protease
Keywords: porcine procarboxypeptidase, serine protease
Deposited on 1997-07-25, released 1997-12-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.169
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Procarboxypeptidase B
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09955 (92-394)
      • conflict (178-179)
    Domains in SCOPe 2.05: d1nsaa1, d1nsaa2
  • Heterogens: ZN, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsaA (A:)
    fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
    fleqnelqyevlinnlrsvleaqfdsvsrttghsyekynnwetieawteqvtsknpdlis
    rsaigttfdgdniyllkvgkpgsnkpaifmdcgfharewisqafcqwfvrdavrtygyea
    hmtefldnldfyvlpvlnidgyiytwtknrmwrktrstnagssctgtdpnrnfnagwctv
    gasvnpcnetycgsaaeseketkaladfirnnlssikayltihsysqmilypysydyklp
    endaelnslakgavkelaslygtsysygpgsttiypaaggsddwaynqgikysftfelrd
    kgrfgfvlpesqiqatcqetmlavkyvtnytlehl