PDB entry 1ns8

View 1ns8 on RCSB PDB site
Description: crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with galactose
Deposited on 2003-01-27, released 2003-02-11
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ns8a_
  • Chain 'B':
    Domains in SCOP 1.63: d1ns8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns8A (A:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    inhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns8B (B:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    inhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfecqvspgseqipelgdislkagekyqattiyslhtklehhhhhh