PDB entry 1ns5

View 1ns5 on RCSB PDB site
Description: x-ray structure of ybea from e.coli. northeast structural genomics research consortium (nesg) target er45
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown Function
Deposited on 2003-01-27, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ybeA
    Species: Escherichia coli [TaxId:562]
    Gene: ybea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8I8 (0-End)
      • modified residue (0)
      • modified residue (11)
      • modified residue (30)
      • modified residue (59)
    Domains in SCOPe 2.08: d1ns5a_
  • Chain 'B':
    Compound: Hypothetical protein ybeA
    Species: Escherichia coli [TaxId:562]
    Gene: ybea
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8I8 (0-154)
      • modified residue (0)
      • modified residue (11)
      • modified residue (30)
      • modified residue (59)
    Domains in SCOPe 2.08: d1ns5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ns5A (A:)
    mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
    laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
    slsaltlphplvrvlvaeslyrawsittnhpyhre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ns5A (A:)
    mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
    laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
    slsaltlphplvrvlvaeslyrawsittnhpyh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns5B (B:)
    mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqm
    laaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsw
    slsaltlphplvrvlvaeslyrawsittnhpyhre