PDB entry 1ns2

View 1ns2 on RCSB PDB site
Description: Crystal structure of galactose mutarotase from Lactococcus lactis mutant E304A complexed with galactose
Class: isomerase
Keywords: mutarotase, epimerase, galactose metabolism, isomerase
Deposited on 2003-01-27, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose mutarotase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • cloning artifact (1)
      • engineered (303)
      • expression tag (339)
    Domains in SCOPe 2.07: d1ns2a1, d1ns2a2, d1ns2a3
  • Chain 'B':
    Compound: galactose mutarotase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZB17 (Start-338)
      • cloning artifact (1)
      • engineered (303)
      • expression tag (339-346)
    Domains in SCOPe 2.07: d1ns2b1, d1ns2b2, d1ns2b3
  • Heterogens: GAL, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ns2A (A:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfacqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ns2A (A:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfacqvspgseqipelgdislkagekyqattiyslhtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ns2B (B:)
    msikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekday
    pgatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqv
    kfslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdas
    esvenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvk
    gidhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhgg
    itfacqvspgseqipelgdislkagekyqattiyslhtklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ns2B (B:)
    sikirdfglgsdlisltnkagvtisftnlgarivdwqkdgkhlilgfdsakeylekdayp
    gatvgptagrikdglvkisgkdyilnqnegpqtlhggeesihtklwtyevtdlgaevqvk
    fslvsndgtngypgkiemsvthsfdddnkwkihyeaisdkdtvfnptghvyfnlngdase
    svenhglrlaasrfvplkdqteivrgdivdikntdldfrqekqlsnafnsnmeqvqlvkg
    idhpflldqlgldkeqarltlddtsisvftdqpsiviftanfgdlgtlyhekkqvhhggi
    tfacqvspgseqipelgdislkagekyqattiyslhtklehhhhhh