PDB entry 1ns1

View 1ns1 on RCSB PDB site
Description: RNA-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures
Class: nonstructural protein
Keywords: nonstructural protein, RNA-binding, ssrna-binding, dsRNA-binding, polya-RNA-binding, dimeric six helical structure
Deposited on 1997-10-02, released 1998-01-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonstructural protein 1
  Species: Influenza A virus [TaxId:11320]
  Gene: J02169
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03495 (0-72)
  Domains in SCOPe 2.05: d1ns1a_
• Chain 'B':
  Compound: nonstructural protein 1
  Species: Influenza A virus [TaxId:11320]
  Gene: J02169
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03495 (0-72)
  Domains in SCOPe 2.05: d1ns1b_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ns1A (A:)
  mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
  gkqivekilkees
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ns1B (B:)
  mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
  gkqivekilkees