PDB entry 1nrl

View 1nrl on RCSB PDB site
Description: Crystal Structure of the human PXR-LBD in complex with an SRC-1 coactivator peptide and SR12813
Class: transcription
Keywords: nuclear receptor, coactivator, PXR, xenobiotic, SRC-1, ligand binding domain, TRANSCRIPTION
Deposited on 2003-01-25, released 2003-08-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orphan nuclear receptor pxr
    Species: Homo sapiens [TaxId:9606]
    Gene: NR112 or PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nrla_
  • Chain 'B':
    Compound: orphan nuclear receptor pxr
    Species: Homo sapiens [TaxId:9606]
    Gene: NR112 or PXR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nrlb_
  • Chain 'C':
    Compound: Nuclear Receptor Coactivator 1 isoform 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_671766
  • Chain 'D':
    Compound: Nuclear Receptor Coactivator 1 isoform 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_671766
  • Heterogens: SRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nrlA (A:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrlA (A:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvsreeaakwsqvrkdlcslkvslql
    rgedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisl
    lkgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklql
    heeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkima
    mltelrsinaqhtqrllriqdihpfatplmqelfgitg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nrlB (B:)
    mkkghhhhhhgsertgtqplgvqglteeqrmmirelmdaqmktfdttfshfknfrlpgvl
    ssgcelpeslqapsreeaakwsqvrkdlcslkvslqlrgedgsvwnykppadsggkeifs
    llphmadmstymfkgiisfakvisyfrdlpiedqisllkgaafelcqlrfntvfnaetgt
    wecgrlsycledtaggfqqlllepmlkfhymlkklqlheeeyvlmqaislfspdrpgvlq
    hrvvdqlqeqfaitlksyiecnrpqpahrflflkimamltelrsinaqhtqrllriqdih
    pfatplmqelfgitgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrlB (B:)
    glteeqrmmirelmdaqmktfdttfshfknfrlpgvreeaakwsqvrkdlcslkvslqlr
    gedgsvwnykppadsggkeifsllphmadmstymfkgiisfakvisyfrdlpiedqisll
    kgaafelcqlrfntvfnaetgtwecgrlsycledtaggfqqlllepmlkfhymlkklqlh
    eeeyvlmqaislfspdrpgvlqhrvvdqlqeqfaitlksyiecnrpqpahrflflkimam
    ltelrsinaqhtqrllriqdihpfatplmqelfgi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.