PDB entry 1nrj

View 1nrj on RCSB PDB site
Description: Signal Recognition Particle Receptor Beta-Subunit in Complex with the SRX Domain from the Alpha-Subunit
Class: Protein transport
Keywords: Signal recognition particle, Transmembrane, Receptor, Endoplasmic reticulum, GTP-binding, GTPase-Effector Complex, Protein transport
Deposited on 2003-01-24, released 2003-03-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle receptor alpha subunit homolog
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SRP101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nrja_
  • Chain 'B':
    Compound: Signal recognition particle receptor beta subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SRP102
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1nrjb_
  • Heterogens: MG, GTP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nrjA (A:)
    mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl
    ltinsehknspsfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlse
    silknrqgqneknkhnyvdilqgieddlkkfeqyfrik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrjA (A:)
    mfdqlavftpqgqvlyqynclgkkfseiqinsfisqlitspvtrkesvanantdgfdfnl
    ltinfnalfylnkqpelyfvvtfaeqtlelnqetqqtlalvlklwnslhlsesilknrqg
    qneknkhnyvdilqgieddlkkfeqyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nrjB (B:)
    gshmgikqksyqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlv
    dfpghvklryklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitessceng
    idiliacnkselftarppskikdaleseiqkvierrkkslneverkineedyaentldvl
    qstdgfkfanleasvvafegsinkrkisqwrewidekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrjB (B:)
    syqpsiiiagpqnsgktslltllttdsvrptvvsqeplsaadydgsgvtlvdfpghvklr
    yklsdylktrakfvkglifmvdstvdpkkltttaeflvdilsitesscengidiliacnk
    selftarppskikdaleseiqkvierrkkslneldvlgfkfanleasvvafegsinkrki
    sqwrewidekl