PDB entry 1nre

View 1nre on RCSB PDB site
Description: receptor associated protein (rap) domain 1, nmr, minimized average structure
Class: cell surface protein
Keywords: alpha2macroglobulin receptor associated protein, low density lipoprotein receptor family associated protein, ldlr family associated protein, helix bundle, cell surface protein
Deposited on 1997-05-08, released 1997-08-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nrea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nreA (A:)
    geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
    lirnlnvilakygldgkkdar