PDB entry 1nrc

View 1nrc on RCSB PDB site
Description: crystal structure of the RNA-binding domain of the u1 small nuclear ribonucleoprotein a
Class: ribonucleoprotein
Keywords: ribonucleoprotein
Deposited on 1992-03-12, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 1994-01-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • conflict (84)
    Domains in SCOPe 2.07: d1nrca_
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • conflict (84)
    Domains in SCOPe 2.07: d1nrcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nrcA (A:)
    mavpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmricyaktdsdiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrcA (A:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmricyaktd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nrcB (B:)
    mavpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifk
    evssatnalrsmqgfpfydkpmricyaktdsdiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrcB (B:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
    lrsmqgfpfydkpmricyak