PDB entry 1nrb

View 1nrb on RCSB PDB site
Description: solution structure of an old world-like neurotoxin from the venom of the new world scorpion centruroides sculpturatus ewing
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1995-01-03, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotoxin v, cse-v
    Species: Centruroides sculpturatus [TaxId:218467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nrba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nrbA (A:)
    kkdgypvdsgnckyeclkddycndlclerkadkgycywgkvscycyglpdnsptktsgkc
    npa