PDB entry 1nr9

View 1nr9 on RCSB PDB site
Description: Crystal Structure of Escherichia coli 1262 (APC5008), Putative Isomerase
Class: structural genomics, unknown function
Keywords: Structural Genomics, Putative Isomerase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-01-24, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein YCGM
    Species: Escherichia coli [TaxId:562]
    Gene: YCGM OR B1180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76004 (2-220)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (112)
      • modified residue (166)
      • modified residue (177)
      • cloning artifact (221)
    Domains in SCOPe 2.07: d1nr9a1, d1nr9a2, d1nr9a3
  • Chain 'B':
    Compound: Protein YCGM
    Species: Escherichia coli [TaxId:562]
    Gene: YCGM OR B1180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76004 (2-220)
      • modified residue (2)
      • modified residue (112)
      • modified residue (166)
      • modified residue (177)
    Domains in SCOPe 2.07: d1nr9b_
  • Chain 'C':
    Compound: Protein YCGM
    Species: Escherichia coli [TaxId:562]
    Gene: YCGM OR B1180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76004 (2-220)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (112)
      • modified residue (166)
      • modified residue (177)
    Domains in SCOPe 2.07: d1nr9c1, d1nr9c2
  • Chain 'D':
    Compound: Protein YCGM
    Species: Escherichia coli [TaxId:562]
    Gene: YCGM OR B1180
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76004 (2-220)
      • cloning artifact (1)
      • modified residue (2)
      • modified residue (112)
      • modified residue (166)
      • modified residue (177)
    Domains in SCOPe 2.07: d1nr9d1, d1nr9d2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nr9A (A:)
    ghmyqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqpl
    aipsdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpw
    ekakafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymsk
    fftlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nr9A (A:)
    hmyqhhnwqgalldypvskvvcvgsnyapeepvlfikpetalcdlrqplaipsdfgsvhh
    evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscp
    lsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvl
    tgtpdgvgplqsgdeltvtfdghslttrvlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nr9B (B:)
    ghmyqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqpl
    aipsdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpw
    ekakafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymsk
    fftlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nr9B (B:)
    myqhhnwqgalldypvskvvcvgsnyavpeepvlfikpetalcdlrqplaipsdfgsvhh
    evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscp
    lsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvl
    tgtpdgvgplqsgdeltvtfdghslttrvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nr9C (C:)
    ghmyqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqpl
    aipsdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpw
    ekakafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymsk
    fftlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nr9C (C:)
    hmyqhhnwqgalldypvskvvcvgsnyapeepvlfikpetalcdlrqplaipsdfgsvhh
    evelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnscp
    lsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvvl
    tgtpdgvgplqsgdeltvtfdghslttrvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nr9D (D:)
    ghmyqhhnwqgalldypvskvvcvgsnyakhikemgsavpeepvlfikpetalcdlrqpl
    aipsdfgsvhhevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpw
    ekakafdnscplsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymsk
    fftlkagdvvltgtpdgvgplqsgdeltvtfdghslttrvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nr9D (D:)
    hmyqhhnwqgalldypvskvvcvgsnyavpeepvlfikpetalcdlrqplaipsdfgsvh
    hevelavligatlrqateehvrkaiagygvaldltlrdvqgkmkkagqpwekakafdnsc
    plsgfipaaeftgdpqnttlslsvngeqrqqgttadmihkivpliaymskfftlkagdvv
    ltgtpdgvgplqsgdeltvtfdghslttrvl