PDB entry 1nr0

View 1nr0 on RCSB PDB site
Description: Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. elegans Homologue Of Yeast Actin Interacting Protein 1 (AIP1).
Class: structural protein
Keywords: BETA PROPELLER, WD40 REPEAT, ACTIN INTERACTING PROTEIN, ADF, COFILIN, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, STRUCTURAL PROTEIN
Deposited on 2003-01-23, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin interacting protein 1
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UNC-78 OR C04F6.4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nr0a1, d1nr0a2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nr0A (A:)
    msefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehsh
    qttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaa
    vgegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppf
    kfkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsg
    svfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsi
    sangfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnr
    vfpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavs
    adgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsga
    svsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakva
    cvswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagq
    dsnikfwnvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nr0A (A:)
    sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshq
    ttvaktspsgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaav
    gegrerfghvflfdtgtsngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfk
    fkstfgehtkfvhsvrynpdgslfastggdgtivlyngvdgtktgvfeddslknvahsgs
    vfgltwspdgtkiasasadktikiwnvatlkvektipvgtriedqqlgiiwtkqalvsis
    angfinfvnpelgsidqvryghnkaitalsssadgktlfsadaeghinswdistgisnrv
    fpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqplglavsa
    dgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgas
    vsevktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvac
    vswspdnvrlatgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqd
    snikfwnvpf